PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 472205
Common NameARALYDRAFT_472205
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SRS
Protein Properties Length: 348aa    MW: 38029.5 Da    PI: 6.5009
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
472205genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702226.84.1e-701142762154
  DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrel......kskkqsalsstkl 91 
             r+g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWv+aakrrerq+qla + +k+ +++       ++++ +++  +      ++   sal++t++
  472205 114 RQGNMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVSAAKRRERQAQLAVLPAKRIRDTnssvggdDDDDREDE--KngggddSCGGGSALACTRV 214
             7899*****************************************************999988877677776522222222..234666689999******** PP

  DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
             ++++s+  le s+lP+e+ss+avfrc+rvss+dd+eee+aYqtavsigGhvfkGiLydqG+++
  472205 215 VNGNSS-GLESSHLPPEISSPAVFRCMRVSSIDDEEEEYAYQTAVSIGGHVFKGILYDQGPSD 276
             ***976.999999***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.4E-63117275IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016237.1E-27119161IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.1E-27226274IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009299Biological ProcessmRNA transcription
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAGLFYLGGR DHNKQDHHQD KDHNEDKSNN YLYLYKDEIY NNNKGFEIFP PQYFQQQQQQ  60
NHVAAPTNLY SFGMVPSGGI NINNNRSTNR SLYFNVVSDH EPVRSSTGGF TVTRQGNMNC  120
QDCGNQAKKD CPHMRCRTCC KSRGFDCQTH VKSTWVSAAK RRERQAQLAV LPAKRIRDTN  180
SSVGGDDDDD REDEKNGGGD DSCGGGSALA CTRVVNGNSS GLESSHLPPE ISSPAVFRCM  240
RVSSIDDEEE EYAYQTAVSI GGHVFKGILY DQGPSDHHRY SSSVNAETSQ HHLNLMDSIA  300
SAATTTAVTA VNSNNGSIDP SSIYTAVAAP FNAYVTAGTS FFAPPRS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAPTransfer from AT1G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9246760.0AY924676.1 Arabidopsis thaliana hypothetical protein (At1g19790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893067.10.0hypothetical protein ARALYDRAFT_472205
SwissprotQ9FXH70.0SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLD7KI570.0D7KI57_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.1__2159__AT1G19790.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-179SHI-related sequence 7